Identify unknown +1-207-570-6*** Wireless phone numbers in Bangor

+1-207-570-6*** is a Wireless phone numbers and is located in Bangor.
Enter a 10-digit Phone Number. Run a search and find out who's calling you now.

Details
+1-207-570-6329 (2075706329) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6128 (2075706128) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6871 (2075706871) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6095 (2075706095) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6464 (2075706464) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6635 (2075706635) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6611 (2075706611) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6287 (2075706287) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6894 (2075706894) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6332 (2075706332) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6833 (2075706833) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6074 (2075706074) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6504 (2075706504) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6091 (2075706091) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6417 (2075706417) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6623 (2075706623) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6849 (2075706849) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6553 (2075706553) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6310 (2075706310) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6386 (2075706386) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6309 (2075706309) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6549 (2075706549) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6481 (2075706481) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6379 (2075706379) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6392 (2075706392) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6402 (2075706402) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6508 (2075706508) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6048 (2075706048) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6751 (2075706751) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6190 (2075706190) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6197 (2075706197) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6829 (2075706829) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6439 (2075706439) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6866 (2075706866) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6560 (2075706560) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6629 (2075706629) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6078 (2075706078) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6123 (2075706123) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6432 (2075706432) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6159 (2075706159) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6775 (2075706775) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6016 (2075706016) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6046 (2075706046) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6055 (2075706055) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6050 (2075706050) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6520 (2075706520) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6928 (2075706928) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6443 (2075706443) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6851 (2075706851) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6235 (2075706235) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6960 (2075706960) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6234 (2075706234) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6134 (2075706134) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6415 (2075706415) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6422 (2075706422) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6620 (2075706620) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6341 (2075706341) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6344 (2075706344) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6934 (2075706934) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6712 (2075706712) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6947 (2075706947) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6687 (2075706687) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6770 (2075706770) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6612 (2075706612) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6360 (2075706360) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6298 (2075706298) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6004 (2075706004) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6225 (2075706225) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6224 (2075706224) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6778 (2075706778) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6221 (2075706221) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6018 (2075706018) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6765 (2075706765) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6664 (2075706664) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6456 (2075706456) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6993 (2075706993) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6575 (2075706575) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6816 (2075706816) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6914 (2075706914) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6283 (2075706283) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6176 (2075706176) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6051 (2075706051) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6488 (2075706488) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6702 (2075706702) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6280 (2075706280) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6047 (2075706047) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6080 (2075706080) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6580 (2075706580) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6968 (2075706968) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6675 (2075706675) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6429 (2075706429) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6845 (2075706845) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6318 (2075706318) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6680 (2075706680) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6746 (2075706746) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6109 (2075706109) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6157 (2075706157) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6179 (2075706179) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6448 (2075706448) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6044 (2075706044) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6932 (2075706932) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6416 (2075706416) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6678 (2075706678) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6948 (2075706948) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6290 (2075706290) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6854 (2075706854) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6903 (2075706903) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6780 (2075706780) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6697 (2075706697) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6394 (2075706394) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6404 (2075706404) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6230 (2075706230) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6164 (2075706164) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6384 (2075706384) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6559 (2075706559) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6721 (2075706721) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6789 (2075706789) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6131 (2075706131) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6458 (2075706458) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6800 (2075706800) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6107 (2075706107) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6594 (2075706594) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6843 (2075706843) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6331 (2075706331) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6354 (2075706354) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6538 (2075706538) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6068 (2075706068) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6459 (2075706459) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6346 (2075706346) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6127 (2075706127) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6600 (2075706600) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6596 (2075706596) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6499 (2075706499) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6297 (2075706297) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6571 (2075706571) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6714 (2075706714) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6503 (2075706503) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6317 (2075706317) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6782 (2075706782) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6497 (2075706497) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6145 (2075706145) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6634 (2075706634) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6039 (2075706039) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6983 (2075706983) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6118 (2075706118) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6013 (2075706013) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6590 (2075706590) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6604 (2075706604) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6238 (2075706238) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6974 (2075706974) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6981 (2075706981) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6124 (2075706124) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6609 (2075706609) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6691 (2075706691) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6689 (2075706689) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6153 (2075706153) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6671 (2075706671) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6995 (2075706995) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6210 (2075706210) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6676 (2075706676) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6015 (2075706015) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6423 (2075706423) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6406 (2075706406) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6584 (2075706584) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6482 (2075706482) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6626 (2075706626) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6753 (2075706753) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6413 (2075706413) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6617 (2075706617) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6971 (2075706971) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6368 (2075706368) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6705 (2075706705) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6652 (2075706652) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6462 (2075706462) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6271 (2075706271) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6433 (2075706433) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6913 (2075706913) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6026 (2075706026) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6062 (2075706062) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6351 (2075706351) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6494 (2075706494) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6841 (2075706841) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6883 (2075706883) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6616 (2075706616) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6545 (2075706545) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6944 (2075706944) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6670 (2075706670) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6338 (2075706338) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6496 (2075706496) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6493 (2075706493) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6347 (2075706347) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6708 (2075706708) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6036 (2075706036) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6065 (2075706065) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6348 (2075706348) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6286 (2075706286) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6769 (2075706769) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6546 (2075706546) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6579 (2075706579) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6803 (2075706803) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6999 (2075706999) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6269 (2075706269) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6636 (2075706636) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6569 (2075706569) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6374 (2075706374) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6233 (2075706233) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6451 (2075706451) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6677 (2075706677) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6976 (2075706976) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6315 (2075706315) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6884 (2075706884) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6698 (2075706698) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6839 (2075706839) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6544 (2075706544) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6848 (2075706848) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6929 (2075706929) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6955 (2075706955) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6101 (2075706101) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6266 (2075706266) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6255 (2075706255) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6668 (2075706668) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6783 (2075706783) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6006 (2075706006) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6838 (2075706838) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6734 (2075706734) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6853 (2075706853) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6305 (2075706305) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6867 (2075706867) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6651 (2075706651) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6135 (2075706135) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6895 (2075706895) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6807 (2075706807) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6597 (2075706597) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6720 (2075706720) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6461 (2075706461) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6005 (2075706005) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6243 (2075706243) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6532 (2075706532) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6805 (2075706805) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6052 (2075706052) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6777 (2075706777) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6207 (2075706207) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6840 (2075706840) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6278 (2075706278) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6199 (2075706199) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6236 (2075706236) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6881 (2075706881) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6017 (2075706017) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6592 (2075706592) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6377 (2075706377) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6359 (2075706359) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6683 (2075706683) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6195 (2075706195) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6040 (2075706040) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6707 (2075706707) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6992 (2075706992) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6527 (2075706527) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6140 (2075706140) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6961 (2075706961) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6181 (2075706181) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6139 (2075706139) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6985 (2075706985) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6595 (2075706595) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6792 (2075706792) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6262 (2075706262) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6889 (2075706889) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6788 (2075706788) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6506 (2075706506) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6551 (2075706551) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6085 (2075706085) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6373 (2075706373) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6576 (2075706576) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6663 (2075706663) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6564 (2075706564) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6054 (2075706054) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6312 (2075706312) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6931 (2075706931) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6969 (2075706969) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6186 (2075706186) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6899 (2075706899) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6732 (2075706732) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6067 (2075706067) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6038 (2075706038) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6852 (2075706852) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6502 (2075706502) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6395 (2075706395) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6701 (2075706701) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6975 (2075706975) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6002 (2075706002) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6466 (2075706466) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6583 (2075706583) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6692 (2075706692) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6920 (2075706920) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6547 (2075706547) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6537 (2075706537) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6125 (2075706125) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6585 (2075706585) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6158 (2075706158) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6603 (2075706603) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6812 (2075706812) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6082 (2075706082) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6615 (2075706615) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6941 (2075706941) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6090 (2075706090) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6923 (2075706923) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6029 (2075706029) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6023 (2075706023) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6355 (2075706355) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6330 (2075706330) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6773 (2075706773) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6517 (2075706517) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6817 (2075706817) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6343 (2075706343) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6369 (2075706369) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6478 (2075706478) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6223 (2075706223) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6115 (2075706115) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6320 (2075706320) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6307 (2075706307) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6160 (2075706160) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6440 (2075706440) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6498 (2075706498) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6510 (2075706510) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6021 (2075706021) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6786 (2075706786) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6568 (2075706568) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6512 (2075706512) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6766 (2075706766) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6886 (2075706886) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6167 (2075706167) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6873 (2075706873) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6801 (2075706801) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6543 (2075706543) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6624 (2075706624) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6872 (2075706872) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6618 (2075706618) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6500 (2075706500) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6524 (2075706524) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6657 (2075706657) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6834 (2075706834) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6760 (2075706760) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6548 (2075706548) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6445 (2075706445) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6552 (2075706552) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6984 (2075706984) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6000 (2075706000) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6706 (2075706706) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6832 (2075706832) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6388 (2075706388) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6152 (2075706152) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6659 (2075706659) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6685 (2075706685) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6254 (2075706254) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6608 (2075706608) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6485 (2075706485) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6081 (2075706081) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6141 (2075706141) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6704 (2075706704) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6069 (2075706069) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6100 (2075706100) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6042 (2075706042) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6661 (2075706661) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6363 (2075706363) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6534 (2075706534) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6855 (2075706855) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6209 (2075706209) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6921 (2075706921) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6208 (2075706208) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6588 (2075706588) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6240 (2075706240) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6053 (2075706053) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6382 (2075706382) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6008 (2075706008) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6365 (2075706365) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6904 (2075706904) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6390 (2075706390) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6554 (2075706554) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6994 (2075706994) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6561 (2075706561) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6291 (2075706291) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6272 (2075706272) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6471 (2075706471) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6306 (2075706306) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6454 (2075706454) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6654 (2075706654) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6425 (2075706425) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6014 (2075706014) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6045 (2075706045) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6001 (2075706001) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6768 (2075706768) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6859 (2075706859) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6774 (2075706774) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6959 (2075706959) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6072 (2075706072) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6622 (2075706622) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6106 (2075706106) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6487 (2075706487) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6426 (2075706426) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6781 (2075706781) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6814 (2075706814) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6252 (2075706252) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6066 (2075706066) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6446 (2075706446) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6194 (2075706194) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6900 (2075706900) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6469 (2075706469) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6350 (2075706350) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6093 (2075706093) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6242 (2075706242) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6771 (2075706771) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6397 (2075706397) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6092 (2075706092) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6767 (2075706767) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6463 (2075706463) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6918 (2075706918) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6735 (2075706735) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6667 (2075706667) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6737 (2075706737) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6738 (2075706738) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6539 (2075706539) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6716 (2075706716) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6733 (2075706733) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6071 (2075706071) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6625 (2075706625) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6748 (2075706748) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6121 (2075706121) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6361 (2075706361) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6277 (2075706277) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6119 (2075706119) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6110 (2075706110) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6185 (2075706185) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6660 (2075706660) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6535 (2075706535) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6313 (2075706313) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6519 (2075706519) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6328 (2075706328) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6528 (2075706528) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6447 (2075706447) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6907 (2075706907) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6693 (2075706693) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6821 (2075706821) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6214 (2075706214) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6340 (2075706340) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6643 (2075706643) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6655 (2075706655) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6335 (2075706335) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6249 (2075706249) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6486 (2075706486) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6177 (2075706177) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6525 (2075706525) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6754 (2075706754) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6474 (2075706474) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6385 (2075706385) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6400 (2075706400) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6951 (2075706951) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6381 (2075706381) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6825 (2075706825) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6270 (2075706270) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6099 (2075706099) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6060 (2075706060) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6828 (2075706828) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6791 (2075706791) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6244 (2075706244) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6200 (2075706200) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6193 (2075706193) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6434 (2075706434) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6229 (2075706229) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6438 (2075706438) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6353 (2075706353) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6364 (2075706364) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6722 (2075706722) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6911 (2075706911) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6730 (2075706730) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6965 (2075706965) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6937 (2075706937) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6495 (2075706495) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6862 (2075706862) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6518 (2075706518) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6621 (2075706621) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6405 (2075706405) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6196 (2075706196) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6574 (2075706574) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6308 (2075706308) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6007 (2075706007) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6424 (2075706424) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6979 (2075706979) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6301 (2075706301) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6756 (2075706756) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6253 (2075706253) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6248 (2075706248) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6295 (2075706295) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6864 (2075706864) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6806 (2075706806) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6294 (2075706294) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6465 (2075706465) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6650 (2075706650) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6088 (2075706088) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6815 (2075706815) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6933 (2075706933) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6449 (2075706449) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6628 (2075706628) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6292 (2075706292) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6943 (2075706943) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6409 (2075706409) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6333 (2075706333) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6602 (2075706602) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6151 (2075706151) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6804 (2075706804) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6799 (2075706799) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6311 (2075706311) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6104 (2075706104) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6201 (2075706201) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6966 (2075706966) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6703 (2075706703) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6882 (2075706882) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6742 (2075706742) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6633 (2075706633) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6724 (2075706724) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6142 (2075706142) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6457 (2075706457) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6111 (2075706111) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6003 (2075706003) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6366 (2075706366) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6427 (2075706427) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6922 (2075706922) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6117 (2075706117) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6638 (2075706638) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6148 (2075706148) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6133 (2075706133) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6877 (2075706877) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6763 (2075706763) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6345 (2075706345) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6940 (2075706940) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6057 (2075706057) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6274 (2075706274) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6755 (2075706755) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6180 (2075706180) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6370 (2075706370) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6165 (2075706165) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6268 (2075706268) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6649 (2075706649) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6924 (2075706924) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6640 (2075706640) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6688 (2075706688) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6281 (2075706281) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6826 (2075706826) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6396 (2075706396) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6869 (2075706869) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6695 (2075706695) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6897 (2075706897) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6725 (2075706725) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6641 (2075706641) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6752 (2075706752) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6577 (2075706577) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6879 (2075706879) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6075 (2075706075) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6607 (2075706607) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6938 (2075706938) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6653 (2075706653) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6337 (2075706337) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6565 (2075706565) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6258 (2075706258) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6076 (2075706076) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6865 (2075706865) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6436 (2075706436) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6823 (2075706823) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6567 (2075706567) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6476 (2075706476) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6741 (2075706741) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6747 (2075706747) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6284 (2075706284) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6102 (2075706102) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6211 (2075706211) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6797 (2075706797) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6570 (2075706570) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6906 (2075706906) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6915 (2075706915) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6627 (2075706627) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6759 (2075706759) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6632 (2075706632) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6393 (2075706393) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6408 (2075706408) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6421 (2075706421) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6888 (2075706888) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6296 (2075706296) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6172 (2075706172) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6247 (2075706247) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6857 (2075706857) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6950 (2075706950) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6980 (2075706980) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6926 (2075706926) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6970 (2075706970) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6407 (2075706407) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6954 (2075706954) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6555 (2075706555) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6556 (2075706556) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6614 (2075706614) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6251 (2075706251) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6203 (2075706203) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6367 (2075706367) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6030 (2075706030) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6610 (2075706610) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6113 (2075706113) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6468 (2075706468) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6772 (2075706772) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6323 (2075706323) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6637 (2075706637) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6540 (2075706540) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6475 (2075706475) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6795 (2075706795) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6472 (2075706472) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6136 (2075706136) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6120 (2075706120) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6263 (2075706263) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6019 (2075706019) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6086 (2075706086) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6460 (2075706460) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6103 (2075706103) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6557 (2075706557) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6303 (2075706303) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6750 (2075706750) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6996 (2075706996) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6665 (2075706665) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6470 (2075706470) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6174 (2075706174) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6321 (2075706321) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6836 (2075706836) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6264 (2075706264) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6232 (2075706232) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6349 (2075706349) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6267 (2075706267) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6173 (2075706173) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6949 (2075706949) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6414 (2075706414) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6758 (2075706758) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6830 (2075706830) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6479 (2075706479) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6669 (2075706669) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6073 (2075706073) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6357 (2075706357) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6973 (2075706973) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6902 (2075706902) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6978 (2075706978) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6946 (2075706946) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6784 (2075706784) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6558 (2075706558) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6155 (2075706155) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6166 (2075706166) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6745 (2075706745) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6484 (2075706484) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6237 (2075706237) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6890 (2075706890) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6739 (2075706739) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6399 (2075706399) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6696 (2075706696) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6562 (2075706562) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6094 (2075706094) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6842 (2075706842) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6656 (2075706656) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6063 (2075706063) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6064 (2075706064) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6509 (2075706509) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6231 (2075706231) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6011 (2075706011) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6796 (2075706796) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6793 (2075706793) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6217 (2075706217) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6130 (2075706130) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6645 (2075706645) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6690 (2075706690) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6246 (2075706246) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6530 (2075706530) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6682 (2075706682) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6822 (2075706822) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6550 (2075706550) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6289 (2075706289) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6178 (2075706178) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6334 (2075706334) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6711 (2075706711) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6908 (2075706908) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6686 (2075706686) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6809 (2075706809) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6444 (2075706444) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6012 (2075706012) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6319 (2075706319) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6083 (2075706083) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6591 (2075706591) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6033 (2075706033) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6648 (2075706648) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6156 (2075706156) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6930 (2075706930) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6905 (2075706905) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6601 (2075706601) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6161 (2075706161) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6957 (2075706957) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6492 (2075706492) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6942 (2075706942) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6387 (2075706387) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6578 (2075706578) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6122 (2075706122) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6077 (2075706077) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6028 (2075706028) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6964 (2075706964) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6163 (2075706163) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6043 (2075706043) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6227 (2075706227) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6713 (2075706713) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6336 (2075706336) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6936 (2075706936) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6727 (2075706727) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6097 (2075706097) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6605 (2075706605) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6204 (2075706204) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6378 (2075706378) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6112 (2075706112) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6925 (2075706925) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6810 (2075706810) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6837 (2075706837) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6216 (2075706216) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6893 (2075706893) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6259 (2075706259) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6878 (2075706878) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6282 (2075706282) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6794 (2075706794) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6058 (2075706058) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6787 (2075706787) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6639 (2075706639) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6887 (2075706887) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6324 (2075706324) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6573 (2075706573) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6785 (2075706785) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6642 (2075706642) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6977 (2075706977) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6477 (2075706477) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6997 (2075706997) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6431 (2075706431) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6820 (2075706820) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6293 (2075706293) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6250 (2075706250) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6572 (2075706572) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6835 (2075706835) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6450 (2075706450) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6850 (2075706850) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6646 (2075706646) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6990 (2075706990) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6389 (2075706389) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6087 (2075706087) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6239 (2075706239) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6206 (2075706206) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6982 (2075706982) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6876 (2075706876) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6149 (2075706149) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6326 (2075706326) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6191 (2075706191) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6989 (2075706989) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6079 (2075706079) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6523 (2075706523) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6070 (2075706070) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6587 (2075706587) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6430 (2075706430) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6613 (2075706613) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6419 (2075706419) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6939 (2075706939) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6300 (2075706300) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6858 (2075706858) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6228 (2075706228) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6189 (2075706189) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6709 (2075706709) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6420 (2075706420) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6958 (2075706958) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6061 (2075706061) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6757 (2075706757) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6863 (2075706863) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6927 (2075706927) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6582 (2075706582) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6022 (2075706022) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6192 (2075706192) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6963 (2075706963) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6662 (2075706662) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6059 (2075706059) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6276 (2075706276) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6168 (2075706168) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6935 (2075706935) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6256 (2075706256) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6441 (2075706441) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6892 (2075706892) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6261 (2075706261) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6098 (2075706098) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6226 (2075706226) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6175 (2075706175) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6304 (2075706304) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6327 (2075706327) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6473 (2075706473) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6875 (2075706875) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6116 (2075706116) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6912 (2075706912) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6599 (2075706599) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6909 (2075706909) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6674 (2075706674) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6452 (2075706452) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6380 (2075706380) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6728 (2075706728) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6184 (2075706184) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6183 (2075706183) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6744 (2075706744) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6339 (2075706339) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6144 (2075706144) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6137 (2075706137) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6790 (2075706790) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6898 (2075706898) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6129 (2075706129) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6986 (2075706986) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6531 (2075706531) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6593 (2075706593) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6811 (2075706811) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6356 (2075706356) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6736 (2075706736) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6089 (2075706089) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6606 (2075706606) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6715 (2075706715) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6513 (2075706513) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6412 (2075706412) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6219 (2075706219) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6972 (2075706972) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6108 (2075706108) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6521 (2075706521) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6827 (2075706827) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6154 (2075706154) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6032 (2075706032) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6776 (2075706776) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6279 (2075706279) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6205 (2075706205) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6860 (2075706860) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6673 (2075706673) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6041 (2075706041) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6630 (2075706630) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6372 (2075706372) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6861 (2075706861) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6009 (2075706009) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6798 (2075706798) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6824 (2075706824) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6362 (2075706362) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6025 (2075706025) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6182 (2075706182) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6699 (2075706699) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6749 (2075706749) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6589 (2075706589) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6024 (2075706024) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6411 (2075706411) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6202 (2075706202) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6515 (2075706515) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6049 (2075706049) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6316 (2075706316) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6542 (2075706542) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6325 (2075706325) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6808 (2075706808) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6507 (2075706507) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6215 (2075706215) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6729 (2075706729) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6910 (2075706910) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6819 (2075706819) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6874 (2075706874) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6170 (2075706170) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6198 (2075706198) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6967 (2075706967) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6437 (2075706437) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6891 (2075706891) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6428 (2075706428) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6489 (2075706489) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6505 (2075706505) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6802 (2075706802) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6666 (2075706666) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6945 (2075706945) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6987 (2075706987) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6455 (2075706455) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6901 (2075706901) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6352 (2075706352) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6401 (2075706401) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6371 (2075706371) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6375 (2075706375) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6764 (2075706764) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6856 (2075706856) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6598 (2075706598) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6376 (2075706376) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6037 (2075706037) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6114 (2075706114) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6084 (2075706084) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6917 (2075706917) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6265 (2075706265) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6285 (2075706285) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6919 (2075706919) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6644 (2075706644) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6147 (2075706147) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6619 (2075706619) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6435 (2075706435) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6779 (2075706779) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6844 (2075706844) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6146 (2075706146) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6514 (2075706514) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6962 (2075706962) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6880 (2075706880) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6700 (2075706700) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6220 (2075706220) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6726 (2075706726) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6672 (2075706672) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6056 (2075706056) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6342 (2075706342) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6885 (2075706885) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6536 (2075706536) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6410 (2075706410) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6681 (2075706681) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6403 (2075706403) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6847 (2075706847) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6501 (2075706501) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6302 (2075706302) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6222 (2075706222) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6761 (2075706761) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6710 (2075706710) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6188 (2075706188) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6529 (2075706529) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6952 (2075706952) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6831 (2075706831) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6218 (2075706218) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6273 (2075706273) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6694 (2075706694) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6299 (2075706299) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6275 (2075706275) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6956 (2075706956) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6171 (2075706171) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6740 (2075706740) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6516 (2075706516) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6162 (2075706162) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6031 (2075706031) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6169 (2075706169) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6398 (2075706398) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6718 (2075706718) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6442 (2075706442) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6868 (2075706868) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6213 (2075706213) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6138 (2075706138) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6491 (2075706491) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6187 (2075706187) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6105 (2075706105) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6647 (2075706647) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6679 (2075706679) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6526 (2075706526) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6035 (2075706035) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6241 (2075706241) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6586 (2075706586) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6998 (2075706998) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6322 (2075706322) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6818 (2075706818) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6143 (2075706143) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6870 (2075706870) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6953 (2075706953) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6581 (2075706581) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6132 (2075706132) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6480 (2075706480) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6563 (2075706563) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6010 (2075706010) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6988 (2075706988) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6358 (2075706358) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6719 (2075706719) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6257 (2075706257) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6684 (2075706684) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6483 (2075706483) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6522 (2075706522) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6314 (2075706314) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6391 (2075706391) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6027 (2075706027) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6034 (2075706034) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6813 (2075706813) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6467 (2075706467) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6541 (2075706541) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6631 (2075706631) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6453 (2075706453) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6916 (2075706916) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6717 (2075706717) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6896 (2075706896) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6743 (2075706743) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6150 (2075706150) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6418 (2075706418) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6846 (2075706846) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6533 (2075706533) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6762 (2075706762) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6991 (2075706991) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6020 (2075706020) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6126 (2075706126) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6731 (2075706731) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6212 (2075706212) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6260 (2075706260) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6490 (2075706490) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6658 (2075706658) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6245 (2075706245) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6723 (2075706723) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6383 (2075706383) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6096 (2075706096) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6511 (2075706511) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6288 (2075706288) Wireless number by United States Cellular Corp. - Maine and located near Bangor
+1-207-570-6566 (2075706566) Wireless number by United States Cellular Corp. - Maine and located near Bangor

Most Recent Comments

  • 440-986-2099

    Ross Appliance Services 201 North Lake Street Amherst, OH 44001-2825 Phone: 4409862099 http:rossapplianceservices. lbu. com I am the leading appliance repair center for the South Amherst area. I am dedicated to bringing the really best repair options to the community. Services: Appliance Repair, Air Conditioning Repair, Heating Repair, Washer Repair, Appliance Repair Service

    Post by Anonymous
  • 714-632-7206

    This guy KAZEM RASSOLI repeatedly called for anything work needed to be done. Have reported to Do Not Call agency.

    Post by Anonymous
  • 323-766-3282

    we live in Texas & I am registered with both the sate of Texas & the National do no ring directory. we got a telephone ring with this no. the other day & request that these people put us on the national do not ring directory. The identical telephone no. rang us back today.

    Post by Anonymous
  • 765-313-3992

    This guy has been stalking us & our girlfriend for the last 5 weeks & wont pass on me alone, this was her mother Brendas telephone no.

    Post by Anonymous
  • 971-160-0232

    form this no. everyday ring come & she irritate me & uses bad words. therefore please check who was he?

    Post by Anonymous
  • 949-208-5961

    I received a text from this number listing a google verification code. I have not made any changes to my google account that would have prompted the text, nor do I have my cell number listed on my google account.

    Post by Anonymous
  • 646-558-2608

    Same thing here.    I work at a medical office and the only information they left was need to discuss practice information with the doctor

    Post by Anonymous
  • 949-945-7261

    claimed a legal matter in court and no name left to return call.    I have never had any legal issues.

    Post by Anonymous
  • 623-209-7481

    Accident Attorney Phoenix 2802 N 37th Ave Phoenix, AZ 85009 623-209-7481 Accident Attorney Phoenix is experienced Personal Injury Attorney representing seriously injured people in Phoenix, AZ. Personal Injury, Personal Injury Lawyer, Accident Lawyer, Accident Attorney, Personal Injury Attorney

    Post by Anonymous
  • 703-348-5596

    They say you have entered a drawing and are a semi-finalist winning a $1000 gift card, possibly a Mustang convertible a trip to Mexico and gift basket They can regurgitate your personal information which is a little unsettling. They are selling magazines and want your credit card number.

    Post by Anonymous
  • 260-866-5733

    these people rang & stated we had a gov't grant & took a no. for our Visa Money Card. these people provided us this no. to ring & confirm & the no. does not work. therefore we had conned again.

    Post by Anonymous
  • 252-937-5555

    picking up service stated this is a hospital. & these people didnt recognise who rang us with that number

    Post by Anonymous
  • 646-567-9850

    Bed Bug Busters NY 88 Chambers St New York, NY 107 (646) 567-9850 http:w.bedbugbustersny.com Bed Bug Busters NY can prepare your home for bed bug treatment. The company is serving all New York, NY area. For more details call (646) 567-9850. Bed Bug Preparation, Bed Bug Prep, Bed Bug, Pest Control Service, Bed Bug Service

    Post by Anonymous
  • 855-848-2844

    I received a call from a man at this number at 8:35 am. He could not pronounce my name and did not say his name. I asked why he was calling and he said he was from United Health care. He asked my date of birth and I told him I do not give out that info unless I know this is a legitimate call from my Insurance company. He immediately hung up with no further comment. This could be a scam.

    Post by Anonymous
  • 562-224-4271

    Got a call from this number soliciting information as to whether or not I used Yaz (birth control pill). Oddly, my sister and mother got the same call minutes from each other. Wonder where people are getting our mobile phone numbers from.

    Post by Anonymous
  • 925-122-0899

    had a ring. woman requested us for our house address & stated he was with 1st flight courier & there was a courier in our name with Govt. of India

    Post by Anonymous
  • 888-206-1488

    I was out of town the week of 10/8 and from 10/08 - 10/12 I had 21 calls from this number on my caller ID!

    Post by Anonymous
  • 800-435-9131

    Got a call from this number, did a redial, and it seemed to be telling me to dial another 800 number for a good time.

    Post by Anonymous
  • 248-429-4200

    never ever a msg. No person. several rings daily! How do I get these clowns off of my phone? I am on the 'national do Not ring List'!

    Post by Anonymous
  • 702-684-9486

    every time this so called company calls or texts  me it costs me money since i have a pay as you go phone! I saw in the USA Today that there is a class action lawsuit against this. I am enrolling since i always save their number for proof, and am also calling the BetterBusinessBuearu!

    Post by Anonymous
  • 214-329-9656

    identical issue here,a indian man (thick accent) on the telephone proclaiming she has money for us fom the government. i am pretty sure it is a con.

    Post by Anonymous
  • 303-519-3355

    phoning about telephone firm. would just like 'em to pass on us alone at late hours of the night!

    Post by Anonymous
  • 215-207-0060

    thank you people for all ur comments. we got put in a job application & this ring stated this is to confirm our application. we could not ring back cos of engaged or code no. needed. we feared we got missed a vital ring. cos of all of you, we feel much better. thanks & God bless you.

    Post by Anonymous
  • 224-265-8124

    Keep leaving messages for someone else, with no callback number on our cell phone.  We call this number back and it is just a high pitch sound.

    Post by Anonymous
  • 515-974-6556

    we got a sms msg with 'spamass3. serve. com' with the following text: 'Community Choice CU Alert: ur CARD has been DEACTIVATED. Please contact me at 515-974-6556 to REACTIVATE ur CARD. '. we dont have a CARD with this firm. . . You can look the no. up in search engine & this will take you to some news stories about this con. dont ring the no.

    Post by Anonymous
  • 404-592-0203

    girl known as Peter called us stating that we owe the previous owner of money, & we want to pay this now or be represented by collection agency. we dont have the money & i am ready to fight this, however we must wonder when this was a con .

    Post by Anonymous
  • 615-543-2243

    someone keeps calling for a linda carroll; my # is used all the time on TV folks it's a real number ya know 5.linda give a real number tjhats yours !

    Post by Anonymous
  • 631-569-5367

    It's a collection service. They're calling to see if a business has outstanding acounts....obviously no credibility because they're doing robo-calls to try and get companies to use the service.

    Post by Anonymous
  • 855-805-5549

    these people keep on phoning us asking for somebody we do not know. Blocking the no. with our mobile telephone provider.

    Post by Anonymous
  • 268-762-0136

    called us at 10:42 pm est. Better not be a telemarketer. our number was on the national do not ring registry for years now!

    Post by Anonymous
  • 606-585-7599

    This person keeps texting me and being immature and is like 40 years old and calling names like a little 10 year old to an 18 uear old and i have never called her one name and she dont need to have a phone and is the easiest lay for any guy out there!!

    Post by Anonymous
  • 786-331-8071

    rang my business & placed a large order. never ever came to pick this up. rang the no. given to figure out this is a working no. Ordered under the name 'Murphy'.

    Post by Anonymous
  • 800-940-9169

    the 'company' was caleld BOR MEDIATION. con caller's attempting to collect money. id thieves. beware!!!

    Post by Anonymous
  • 914-339-9584

    Person claimed they were from a mother company called Cash Advance Payday saying I got a loan from them and they are filing a suit against me for a loan I never ever got, don't even know them and threatened to come up to my job & have me arrested. When I challenged them, they hung up.

    Post by Anonymous
  • 904-507-4053

    Spewed a automated msg onto our picking up machine. stated this is circulation services telesales with the Florida times Union newspaper. they have been phoning with other no.s too. Does anybody recognise when the telephone co's ring blocking feature can quit this?

    Post by Anonymous
  • 661-206-0780

    This no. 661-206-0780 keeps on phoning our office telephone no. & it is playing republican political news updates over & over. No one was at the other end & this just keeps on playing over & over.

    Post by Anonymous
  • 212-111-1661

    Just got a ring with 212-11-1661 who turned out to be Aaron with Olympia. she requested for the CEO by 1st name. she did not get any further.

    Post by Anonymous
  • 619-568-0003

    stated these people rang in reply to inquiry --resume bucket-- highly unlikely , these people rang a non- profit org.

    Post by Anonymous
  • 209-631-1522

    They said someone is stealing money from my bank account in Mexico when my bank account isn't reachable and i am to young to own a credit card.

    Post by Anonymous
  • 972-535-3499

    I got the same call today and established an account assuming that was the new way calls would be made from the SC prisons. I regularly correspond with a lady who is incarcerated and sometimes she calls. At the end of the call it said to hang up to process the transaction. I assumed that I would soon here from my friend and that an attempted call generated the request. Now I am not sure as she has not called. The request sounded reasonable since the prison has handled calls with a credit line before. I will be calling the prison headquarters tomorrow to see if they are using this group. If not will probably cancel my card. The Texas area code did not bother me at the time as I assumed it was a contract agency handling the phone calls. Now I am worried that someone has gotten a listing of peple getting calls from the prisons and scamming for credit card numbers.

    Post by Anonymous
  • 310-499-1134

    we happen to be receiving continuous rings with this no., over numerous weeks. when we reply these people hang-up & when we ring back these people do not reply & the voice mail-box was full!

    Post by Anonymous
  • 716-923-7488

    This company is rude and have been calling me on a credit card bill from my ex.. they say they are going after me b/c they cannot find her and are rude.. I have sent them stop harrassing me a work letter and they continue to call. Will be contacting lawyer asap about them!!

    Post by Anonymous
  • 330-433-5970

    this is absolutely stupid. phone calls constantly for 3 days with nothing but hang ups. tired of this turning over to better business bureau.

    Post by Anonymous
  • 510-228-1944

    # Federal Trade Commission - Division of Advertising PracticesThe Division of Advertising Practices protects consumers from unfair or deceptive advertising and marketing practices that raise health and safety concerns, as well as those that cause economic injury. It brings law enforcement actions in federal district court to stop fraudulent advertising practices, coordinates FTC actions with federal and international law enforcement agencies sharing authority over health and safety products and services, and monitors advertising and marketing of alcohol, tobacco, violent entertainment media, and food to children. The Division also brings administrative lawsuits to stop unfair and deceptive advertising.

    Post by Anonymous
  • 360-322-6081

    we did not pick up.  There is no msg therefore we searched for this. Apparently it is really popular.

    Post by Anonymous
  • 805-659-3277

    Jerk keeps calling over two weeks when you answer three clicks and then hangs up. You try and call to complain of course it is busy. Comes up as DSP.

    Post by Anonymous
  • 916-868-9209

    My friend has texted me from this # multiple times I'm pretty sure she was staying at the watt/ I-80 motel6 in north highlands, ca so maybe it belongs to the motel somehow, she can't make calls so it might have something to do with wifi

    Post by Anonymous
  • 760-679-5062

    I got a call from this number today and they hung up in my ear. I called them back & an automated message said I was eligible for a free medical alert system. "You know the kind where you can press a button when you've fallen." The message went on to say that the user would be connected to emergency services who would stay on the phone until the EMS arrived at the user's location. I saw something on the local news that this system was a scam & was not free.

    Post by Anonymous
  • 866-949-6219

    I got a charged transaction from this number on my Credit Card.I dont know who they are, they are investigating right now.

    Post by Anonymous
  • 727-865-4374

    Received a call in December 2011 but missed it, no message left. Called back and it rang once then went to hold music so I hung up.

    Post by Anonymous
  • 605-209-5145

    The florida number is a legitimate florida company who's having to deal with this nonsense...they are NOT associated with this text message.... the text messages that are coming from 605-209-5145 are scams...don't fall for it..report this 650-209-5145 number to your cell phone carrier to STOp these jerks!!!!

    Post by Anonymous
  • 757-961-9544

    call and claimed I filled out an online survey, when questioned about their company information, they hung up.

    Post by Anonymous
  • 702-802-6700

    individual proclaiming to be grandson in therefore America. Needing money to get out of jail. FRAUD! con!

    Post by Anonymous
  • 866-756-3358

    This was a call from Verizon Customer Care - probably a 3rd party caller, as it came up as 'Unavailable'

    Post by Anonymous
  • 778-565-1306

    SEE     778-565-1042'I've received several calls from PGHS. Some of the calls came from different numbers. For example. 778-565-1042, 778-565-1392, 778-565-1410 and 778-565-1306. When I was around to answer the phone (778-565-1410) they told me they were from Pro Group Home Service. I told them to take my number off their dialing list now! We'll see what happens.'CHRIS

    Post by Anonymous
  • 302-898-6738

    UihfdfxhsgrsgaesesryerhsyrsyyrsryfdfhsgrartadfststreeatereratseyhdjteutastarhsghdjgdghdjfwyrdtjdtidttetaewttsutstvjmchfhifyuduyfydihdutsrhsfgadgadartaraaeaasdarshrsthrttdbsffshfdgdGjstusrushtsrtdtudfysyrdysrhddyrsyrsyrsydryydtrtdstttrsdyudsysyrstkrsyysrkrrsksrtirkdykysrsryksryyrsryjsjdyrhgkdyfkxgkgdfjjfdjdhcfgfjfgforgfofgfifhfofmdksmasgawnnwnsisgkhdvhkfdvcfhkfcvihcug r

    Post by Anonymous
  • 903-634-3233

    This # called me a few times and just want to make sure everything is ok. i called it back many times and got no answer.

    Post by Anonymous
  • 206-496-0951

    Robo call: 'you've been carefully selected' for a 'short survey' to a University staff work line listed in 'don't Call' directory.

    Post by Anonymous
  • 303-555-1234

    Calls between 8:00 AM - 9:00 AM many mornings a week; no answer; many 'businesses' use this fake number according to a Google Search

    Post by Anonymous
  • 551-054-0000

    llaman y llaman casi todos los dias preguntan siempre por la misma persona, es una mujer y luego te pregunta tu nombre....* No den ninguna informacion a nadie*

    Post by Anonymous
  • 501-554-6516

    Received unwanted text message today: "Do you need some extra $ today? We can get you up to $1500 right now by going to www.rushhelpcash.com - TXT 'NO' to cancel all future alerts."

    Post by Anonymous
  • 209-920-4584

    I got a call from this number couple of times last week.Claims to be a international telephone service company.Some how these guys get list of customers of Reliance India.Watch out and don't sign up for anything unless you are convinced.

    Post by Anonymous
  • 206-496-0929

    Total spam, be aware of the 'winner' spam scheme the took an elderly lady's total saving and checking money, drained everything

    Post by Anonymous
  • 610-167-3277

    Same 'company' as 206-397-1131. Told them this morning to put me on dnc list. I usually don't answer but I have a wicked headache and it feels good to yell at someone and not feel guilty about it later. Obviously Not a legitimate company if they are calling from 2 different area codes. Not going to answer anymore but will log the number of times they call and take it from there.

    Post by Anonymous
  • 727-556-5492

    Yes This number keeps showing up under caller ID. Have never answered. Same thing no message is left.

    Post by Anonymous
  • 310-451-3373

    Hackman Sally Phd MFT in Santa Monica, CA serves clients. I offer services in Counseling Services. I specialize in counseling, child counseling, women's issues, relationship issues.

    Post by Anonymous
  • 201-257-4929

    rings come & no reply soon as we ring back, these people pass on no msg & We are on the national do not ring directory.

    Post by Anonymous
  • 800-701-1672

    This was the number for Hauge Associates. . this was a Collections company that was related with Check Rite in Sioux Falls

    Post by Anonymous
  • 484-352-2517

    I don't know who this is but they are calling me every day.and never leave any messages.some times they said they are calling about switching the electric company.however I explain to a person who called that time not interested in their business .but this number wont stop calling me .Please Please stop them from calling me again ?Thank You So Much.

    Post by Anonymous
  • 513-322-1461

    Blimey - what is this about, Luvvy? Not a sales call? Why the cloak and dagger approach? Answered once and heard that voice and its announcement, hung-up and let subsequent calls go to the machine - no messages left. Do these folks think that the recipients of their calls care who they are?

    Post by Anonymous
  • 888-724-7998

    Just got a call from this number on my business line and finally a guy tells me he got the wrong number.

    Post by Anonymous
  • 314-478-2376

    FYI this is a scam text message for a fake pay day loan scam. Block this number so you dont get scammed.

    Post by Anonymous
  • 301-740-3487

    2 rings earlier today & 2 hang ups once the picking up machine answered. Dorothy Claxton shows on caller-id.

    Post by Anonymous
  • 876-442-9193

    These people have called me twice the first time I was a secodnt place winner and won 3.5 million cashier's check and 50.000 cash and a car, the next time it was 250,000 cashier's chech and only about 20,000 cash. All i had to do was purchase a money card with $486 on it and give them the number on the card so they can deliver the money to me.they've called me twice in the past two days. It was pretty easy to realize its a scam. The first time they called it was from one organization, the next time I was a PCH winner.

    Post by Anonymous
  • 707-437-8988

    This number has shown up on our caller ID dozens of times. Finally picked up and they asked for a deceased relative. When told there was no such person living here they hung up without a word. Scumbags.

    Post by Anonymous
  • 575-578-1644

    robo ring selling emergency response. have got several rings with 'em , afternoon , noon, evening. really irritating.

    Post by Anonymous
  • 253-246-8510

    Called repeatedly on the Emergency Cell line for a human services agency. I pressed '1' to talk to a real live person, and when I told them this was an emergency line, they hung up on me.

    Post by Anonymous
  • 917-524-6731

    Caller sent me this number from a social site asking me to text to them. Apparently this caller is attempting to scam other people somehow.

    Post by Anonymous
  • 602-354-4827

    The person that called from this number said I had placed an ad to work from home for Google. I have done no such thing.

    Post by Anonymous
  • 330-230-2677

    Tired of being on the 'National Do Not Call' lists, on landline & 2 cells, and continue to get these calls that don't leave a message! What good does the 'NDNCL' do??

    Post by Anonymous
  • 347-913-9415

    This individual will sms us things just like you've ur underwear please come claim this. these people sms us atleast once a month

    Post by Anonymous
  • 757-209-2013

    West Asset Mtg. exactly what a bunch of jerks! soon as we requested for a statement therefore i would have proof of the bill these people stated I cannot do that, I can send you a bill however nothing itemized! WHAT?!?! you can send us a bill & pester us daily however you cannot send us a bill stating exactly what we apparently owe for???

    Post by Anonymous
  • 661-748-0240

    just recieved 2 calls in a row from this number. I dont use Skype, since apparently this is the origin of the number. No message left. I called the number back, and got a recording stating i was dialing a skype number. Go figure, with all the fraud and id theft going on, what else do they have to do?

    Post by Anonymous
  • 815-517-9318

    We get 1 call per day, sometimes 2 from this number. Never leaves message and if answered...no one responds, hangs up.Want it to stop!

    Post by Anonymous
  • 661-748-0244

    This is a scam phone number. I almost sent a guy $600.00 shipping deposit for a motorcycle located in Italy and this is the number he has called me from multiple times about shipping details and financial details of the transaction. BEWARE!!

    Post by Anonymous
  • 800-000-0003

    Call looking for the people that live next door, new my address and name and said he got my number from a crosses references

    Post by Anonymous
  • 662-137-9466

    Keep calling any time day or night hangs up this number is out of utah don't know anyone from this number or utah this is harrassment to my family

    Post by Anonymous
  • 215-344-2924

    I just got a call at work from a man with a very thick Indian accent trying to collect money for something I was never affiliated with. The call came from 215-344-2024. I told the individual that I will report him to local authorities (which I will) and post if I can his scam on the Internet.

    Post by Anonymous
  • 863-455-9723

    Residential and Commercial Moving TC 4 Orange St W, Davenport, FL 33837 (863) 455-9723 city-data.com DirectionsSearch nearbymore Categories: Mover, Moving Company, Residential Movers, Commercial Movers , Pack And Unpacking

    Post by Anonymous
  • 778-858-2818

    Offers you a Mystery Shopper job and sends check, you have to wire cash back to them.  Then the check bounces.

    Post by Anonymous
  • 626-668-8231

    I keep getting calls from 616-668-8231, sometimes as many as 8 times in a single day. I'm on the Do Not Call list, but that appears to mean nothing. My intention is to contact Paging Plus, with cc to appropriate Federal authorities to close down this fly-by-night operation. Suggest that everyone who has the same problem follows the same procedure. If the phone company gets flooded by complaints, maybe they'll do something about this. I'm tired of paying for cell service and then being harassed with unsolicited calls!

    Post by Anonymous
  • 360-322-6371

    Received an automated call discussing costumer advocacy for pregnant women. When I followed the instructions and pressed 1 to speak to someone, they disconnected immediately.

    Post by Anonymous
  • 713-275-3575

    do not shop for a vehicle at Bob Howard Automall, or you'll get a barrage os rings with this no.

    Post by Anonymous
  • 202-666-7770

    Got a call today from this number, 1-202-666-7770, District of Columbia, wasn't home when the call came in and no message left....but after reading all these comments, now I know....

    Post by Anonymous
  • 201-891-1029

    MEDCO calls from a TOLL FREE # not one showing an area code other than 800 , 877, or 888 ...etc.  . and to the person saying they CAN leave a message, YES they can, and have asked us to authorize them to leave a message, so if this 'person' isn't leaving one, and MEDCO knows THEY can, most likely it's NOT MEDCO calling.grow up people... there's a war on.... don't be a moron ... don't give personal info to someone that isn't verifying who they are, if you haven't any reason to have a call from them.... especially if THEY don't leave a simple message, after having you 'sign' an authorization that they can, in the future.

    Post by Anonymous
  • 971-220-1032

    Similar calls from OR afterI filled out app for insurance for self employed. Won't stop calls. Is their a virus bomb to email these asses!

    Post by Anonymous
  • 310-599-5731

    firm keeps on phoning although I am on dont ring directory & have chosen to delete no. numerous times.

    Post by Anonymous
  • 561-692-4228

    The Calling-ID states Belle Glade, FL. This robot rings nearly every day. How do we get rid of this?

    Post by Anonymous
  • 405-885-3199

    Garys Roofing LLC- Contractor, Repair, Installation7300 NW 23rd Street Bethany, Oklahoma City, OK 73008405-885-3199    w.garysroofing.net    Garys Roofing LLC- Contractor, Repair, Installation is a roofing contractor offering services like roofing repair, roofing installation and roofing in Oklahoma City, OK. Roofing contractor,Roofing repair, Roofing installation,Roofing

    Post by Anonymous
  • 206-276-8396

    I got 1 call from this number and it was at 11 am. They left no voicemail so I figured it wasn't anything important

    Post by Anonymous
  • 404-920-8657

    I got the same call from Ben Ford I did research he doesn't work for Blakewood he works for some Investigations Firm but he represented his self to work for Blakewood when I called Blakewood they were not aware of this man so be advised if this pretender calls you saying he works for Blakewood and he is an investigator...

    Post by Anonymous
  • 616-613-2126

    These guys know they are breaking the law. This number is a known spammer number that has been reported to the government as a DO-NOT-CALL violator. The government does nothing.

    Post by Anonymous
  • 778-329-4105

    it used to be phone line for a psychic line calledmyphoneadvicefor i was a reader on that site. but i hardly ever log on for they never advertize. it seem now the site doesnt exist anylonger

    Post by Anonymous
  • 716-408-0382

    got three rings with these idiots in 1/2 hour, just a pre-recorded ring with a 'auto insurance advisor'. BTW- i am on the no-call directory.

    Post by Anonymous
  • 727-330-3750

    I get a call at least twice a day from this number. I'm usually busy when they call, but they never leave a message and I can never call back.

    Post by Anonymous
  • 888-222-4227

    You get this call if you have financing on your car. Santander is a finance company that offers financing to high risk customers offering high interest rate. It's probably a courtesy call or a follow up.

    Post by Anonymous
  • 818-207-8300

    I was quite pleased with PC Mac Service Technicians actually. I think if youre in North Hollywood, CA and need computer networking - theyre the people you need.

    Post by Anonymous
  • 310-599-5750

    these people ring me. I ask 'em not to ring me. I do not need a single thing these people must offer. Bottom line, these people call, & ring & call,. . . . .

    Post by Anonymous
  • 502-295-6827

    this is the name and contact for the person or persons who own and manage the site and are culpable for spamming: Domain Name: HOMEINCOMENOW7.COM Registrant Contact: zhang lei zhang lei [email protected] telephone: +86.01012354345 fax: +86.01012354345 beijingshichangjiangnanlu12hao beijingshichangjiangnanlu12hao Beijing 123524 CN Administrative Contact: zhang lei [email protected] telephone: +86.01012354345 fax: +86.01012354345 beijingshichangjiangnanlu12hao beijingshichangjiangnanlu12hao Beijing 123524 CN Technical Contact: zhang lei [email protected] telephone: +86.01012354345 fax: +86.01012354345 beijingshichangjiangnanlu12hao beijingshichangjiangnanlu12hao Beijing 123524 CN Billing Contact: zhang lei [email protected] telephone: +86.01012354345 fax: +86.01012354345 beijingshichangjiangnanlu12hao beijingshichangjiangnanlu12hao Beijing 123524 CN

    Post by Anonymous
  • 714-362-6515

    Need fast cash in your bank account within 1 hour? Get an instant payday loan now! Text YES for more info, NO to be removed from su.rvey-a spam text I received from 7143626515 apparently trying to obtain my personal info.

    Post by Anonymous
  • 208-209-2459

    This number 2082092459 is from Hayden Idaho. This number keeps calling repeatedly and were told to stop and they never stop. I had this number blocked but they call from other numbers.

    Post by Anonymous
  • 253-236-2179

    I keep getting these calls from 'Credit Card Services' masquerading as MY credit card company!!!! They called me atleast a thousand times in the past two years!!! IM SiCK OF IT!! I say we all band together and file a class action law suit against them!!!! For harassment, impersonating a credit card company and whatever else we can drum up. If we all start logging the times and dates of the calls. Also write down everything they say. Better yet try to record them And find an attorney to take on our case, we can stop them!!!!c'mon I'll be the 'Erin Brokavich'. Email me. [email protected] IT!!!

    Post by Anonymous
  • 510-699-9230

    we just had a ring on our mobile telephone which was on the donotcall directory. i am in Boston, & do not expect rings with the CA area. No msg.

    Post by Anonymous
  • 760-913-9720

    Bail Bond Service. Imperial CA was offering bail bond, bail bonds, bail, bail service & bail bonds service in 110 East Barioni Boulevard Imperial, CA 92251 Bail Bond, Bail Bonds, Bail, Bail Service, Bail Bonds Service

    Post by Anonymous
  • 206-501-3143

    Foreign guy just called me from this number. Said he had an important legal matter to discuss with me. Did not answer call. He left a message. Had an accent. Said he was from American Credit Services and it was very important that he speak with me. Is this a

    Post by Anonymous
  • 876-354-0861

    Received many calls daily over the last 4 months. Once told them they were a rag head and to speak English. They told me they were in LaVegas, and got stuck in customs trying to get to us. Hello! When your in the US already you don't have to go through customs

    Post by Anonymous
  • 734-325-1765

    Have received several calls from this #, never leaves a message.  I finally returned the call and got a recording stating, 'thank you for calling T-Mobile' - interesting since I have Sprint.

    Post by Anonymous
  • 999-910-0223

    Received a call 2011/09/17 from East Indian man with a heavy accent saying he was from Microsoft. He said that my computer was infected and asked me if it was slow. He was obviously reading from a script because his replies were not consistent with my replies. He wanted me to go to a website and he would fix the problem. I refused and said if he was from MS then send me an email. I hung up. A few seconds later he called back. I never answered. A quick search on the web revealed it's poor attempt to scam people.Alberta, Canada My caller ID displayed:Invalid NPA999-910-0223

    Post by Anonymous
  • 876-565-6591

    they tell me to get my check book out to verify checking account.i tell them you tell me what the number is.then they hang up,you can tell by the accent they are jamaican.

    Post by Anonymous
  • 626-831-9842

    someone keeps calling me from this number and hanging up. i think it is my ex boyfriend. could you please help

    Post by Anonymous

Recent Suspicious Numbers